PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 2233aa    MW: 253365 Da    PI: 6.6883
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046430.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3452e-14844927296
                     EEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     fk l     + s+ +++p  f+ ++ +g   e+kt  l++  s ++Wevk+   +++    +t+GWkeF+ a++L+ gD+vvF+ ++++ f  +v
  Csa16g046430.1 844 FKPL--LPGFYSH-VTIPVAFLLKNvKGH--EQKTAELRSeASKKTWEVKI--HGQR----ITDGWKEFAVAHDLRIGDIVVFRQESDMAF--HV 925
                     5666..5566666.99******9**6444..4569999995566*******..6666....9**********************6666777..77 PP

                     EE CS
              B3  95 kv 96 
                     ++
  Csa16g046430.1 926 TM 927
                     65 PP

2B373.13.4e-239761069498
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3    4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96  
                      + +++++l  +rl +p++f++e+g++++++  ++l++e+grsW+v l+ +++ g  ++++GW++F++an+L++g f++Fkl++r +++lv+++
  Csa16g046430.1  976 ANITASTLLYDRLNFPRSFVRENGLDTRCGEIVVLMNEKGRSWTVDLRGKRSCGIAYIKRGWRKFCQANELRAGSFFTFKLIQR-GRTLVLRL 1067
                      56788888899************************************88888888***************************95.55567776 PP

                      E- CS
              B3   97 fr 98  
                       +
  Csa16g046430.1 1068 SS 1069
                      65 PP

3B354.52.1e-1711261219499
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3    4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96  
                       +++s++ k +rl+lp +f++  g++k++  ++++ d++g +W+  l+++kk  r+ l +GW eF++an++k g++v+++l+++  ++ v+k+
  Csa16g046430.1 1126 LTLTSYNVKCSRLTLPIHFTKVSGIVKAK--KMSFLDKHGVKWSTDLRFDKKHLRMRLVGGWIEFCDANHVKIGESVMLELIWEAHESSVLKF 1216
                      5679****************888999655..8**************************************************99777788888 PP

                      E-S CS
              B3   97 frk 99  
                      ++k
  Csa16g046430.1 1217 CSK 1219
                      876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813839.03E-658101IPR001810F-box domain
Gene3DG3DSA:1.20.1280.509.2E-463101No hitNo description
PfamPF006460.005366101IPR001810F-box domain
SMARTSM002560.2970111IPR001810F-box domain
PfamPF006466.3E-4460496IPR001810F-box domain
SMARTSM002561.8464505IPR001810F-box domain
PfamPF034781.6E-6717755IPR005174Domain unknown function DUF295
PROSITE profilePS5086311.773840931IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.8E-21841943IPR015300DNA-binding pseudobarrel domain
CDDcd100177.25E-14842928No hitNo description
SuperFamilySSF1019361.43E-16842937IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.5E-20843931IPR003340B3 DNA binding domain
PfamPF023624.9E-10853924IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-219661068IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-199681068IPR015300DNA-binding pseudobarrel domain
CDDcd100177.46E-209731067No hitNo description
PROSITE profilePS5086315.0169731071IPR003340B3 DNA binding domain
SMARTSM010195.3E-299741071IPR003340B3 DNA binding domain
PfamPF023621.4E-219751069IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-1811171219IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-1911191222IPR015300DNA-binding pseudobarrel domain
CDDcd100177.78E-1611221217No hitNo description
SMARTSM010199.9E-1911231220IPR003340B3 DNA binding domain
PROSITE profilePS5086313.04211231219IPR003340B3 DNA binding domain
PfamPF023624.1E-1711241219IPR003340B3 DNA binding domain
PfamPF006460.004712331270IPR001810F-box domain
SMARTSM002562512371280IPR001810F-box domain
PfamPF006460.003316441679IPR001810F-box domain
SMARTSM002562.416481690IPR001810F-box domain
PfamPF034781.7E-619251975IPR005174Domain unknown function DUF295
PfamPF006460.001120222058IPR001810F-box domain
SMARTSM002562.620262069IPR001810F-box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 2233 aa     Download sequence    Send to blast
MAPRKKTPNM IWVRKSQQPE NMAKPATEET NKSLLDCSPL LEELPQSSNS VAEQPATKEQ  60
TLSKLDWSRL PEELLHIISD NLEDCFDVIH ARSVCHPWRS IFPFPSCLLG TSYSLPYFSK  120
FPRKSKGYCT LEKFPMFLFR VLAPAVGLPS EFFVGGINRD KSVKALPSPF QCSVKVNIPD  180
SEPTLMNVLD CQILPLGFQY RMVGWDPQSL ATSFRGVASL PLGEGEFVVL IGYSHNLLVL  240
TSADMRWMRL EKTSRADCKD IVTFRGRFYA VFLNGDVFVI DPYTLEATPL VPSERLNSQN  300
YLVPSGNDEL FLVEMIIVRG SVIDFSKLAC RVSRLDEEAG EWVVVNDLGG RVLLIGQPGN  360
SCCSARELPD GCGVSENSML FTNEPFGSTY CYKYGVDTGN AEDDLNFWRS SKETCVTIFR  420
TSPMVAFLCI EHKNPFAAVS FCLNQANMAK KEKISSLYPD WSQLPDELQQ VISKKLEDYC  480
FDVVHARSVC RTWRSVFPFP SCLLRPSYSL PSFPGFHIED EDSCTLEMVP LFLFRIRTPP  540
PAANVVWPSV YLLGAIGRDE SDDHMKLLPS PLQCSVKLNI PESEPILMNM LYCQIIPLGH  600
QYRVIGWGPQ ELTLYHKSVV LLPTRIRCAS HTHILERFYA SFEAREIVVI DPYSLEVTPM  660
MPSQPLLSGD YLIPSGDDEL FLVENFYPVP VADEIDFNRF TCRVSRLDEE AGKWVVVSVL  720
GDRVLFLGHF GNVCCSAKEL PDGCGVTGNS ILFTNDRNVT FAYKYGLHTG RAEDELNIWR  780
FSREKRVTIL STSPVVALRV DDRSENLALA PADVSPSEFF LGYSETKKRL RDLGTLIMAS  840
QHFFKPLLPG FYSHVTIPVA FLLKNVKGHE QKTAELRSEA SKKTWEVKIH GQRITDGWKE  900
FAVAHDLRIG DIVVFRQESD MAFHVTMLGP SCCEIQYVSC LNDHNNLGKI QRKKRVRKNP  960
SREPESSSLD PSCFVANITA STLLYDRLNF PRSFVRENGL DTRCGEIVVL MNEKGRSWTV  1020
DLRGKRSCGI AYIKRGWRKF CQANELRAGS FFTFKLIQRG RTLVLRLSSK ETEANEVESL  1080
STEQESDEER SQDGISLQQN SQRKERKGTL IRKDSYSASQ NRYVTLTLTS YNVKCSRLTL  1140
PIHFTKVSGI VKAKKMSFLD KHGVKWSTDL RFDKKHLRMR LVGGWIEFCD ANHVKIGESV  1200
MLELIWEAHE SSVLKFCSKV SKQQPCQSPS VPDWSLLPQE LLHLIAKDLE DEEYCFDVVH  1260
ARSVCTSWRS SFPFPSCLLR PSYSLPTFSD ESKVLCTVEK IPLFLFRVKT PAVSPSVFYL  1320
GDLGRDNSRD HMELPSPLQC SVRMQLPGSD PTLMNMLDCQ IISLGHQYRV IGWDPESWTS  1380
PYRGVALLPL NKEGGGEDFV VILNFTNDLV VFRSEETRWV RLGKITDTSC QKVLTFRGRF  1440
YAAYLNGDIF VIDPYSLEAT LMNPADHFSS INYLVQSGND ELFLVEATIP QAEVVEVSRL  1500
TCRVSSLDED AGEWDVVSDF EDRVLFIGEQ GNVTCSAKEL PDGCGVSGNS MLFTDWPGDA  1560
IYFYKYGVPT EYAEDDLNFW RLSREYRVKI LNKSPPVVNH VLVVCVETTS LVNAYQFSSS  1620
YKFRNHTTMA TRKKTSSSSS MLPNWSLLPE ELLQIVSKYV EDCFDVFHAR SVCNSWRSTF  1680
PFPSSLLRPS YSLPTFDEVT LESKELCTLE KVPLFLFRPR APTIAANSSL ASEYFLGGIG  1740
RDDHHLDLPS PLQCSVKVQI QGYDPALMNM VECQILPLGH QYRLIGWEPK GYRGVAFLPL  1800
NKEGRRGEFV VILNYTNVLL VLTSAEMKWK RLENVPAGSV CSDLGTFRGR FYASFLARST  1860
FIIDPYSLEV TLLMPSPPKP LNYLVASGDD ELFLVEVTIP MFEEIDFSRF TCRVSRLDEE  1920
CSKWVEVRDL GDRLLFIGHF GNVCCSGKEL PDGCGLSGNS IVFTNEPTFP YKYGVHTGTG  1980
EDDLDCWRTT RENRVMIFNT DPITNKLNFN YRRKKMSSMK PDWSQLPEEL LPLISKKLAA  2040
YCFDVVHARS VCRTWRSVFP FPSCLVRPSY SLPSFADFPI ESKDLCTLEK VPLFLFRLRA  2100
PVASAALPCE YTLGGIGRDD HHLELPSPLQ CTVKVKFRGS DPTLMKILDY QILPLGYQYR  2160
MIGWDPERWI RYYRGVAFLP LNKDGEFVVL LNYAKVLLVL ASVEMRWKRL TNVPNYQCTD  2220
LVTYRGRFYA VF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472486.10.0PREDICTED: F-box/kelch-repeat protein At1g64840-like
RefseqXP_010472487.10.0PREDICTED: F-box/kelch-repeat protein At1g64840-like
SwissprotQ9XIR11e-140FBK27_ARATH; F-box/kelch-repeat protein At1g64840
TrEMBLM4ETD70.0M4ETD7_BRARP; Uncharacterized protein
TrEMBLR0FWT30.0R0FWT3_9BRAS; Uncharacterized protein
STRINGBra032068.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-113B3 family protein